PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.03YVC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family bHLH
Protein Properties Length: 238aa    MW: 27127.8 Da    PI: 7.3443
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.03YVCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH25.52.3e-083885655
                 HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                 n  ++  R+++ + ++ Lr+llP ++   ++K s ++   +Av+YIk++q
  Araip.03YVC 38 NDSDKILRKEMATLYSSLRSLLPLQF--IKGKRSISDHMNEAVNYIKYMQ 85
                 5667889*****************65..********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.7943284IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.2E-53885IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.85E-838107IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.14E-53889No hitNo description
Gene3DG3DSA:4.10.280.102.9E-645103IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MFPLQRGNEL VIQFSNSSHQ HKISQDLILE DYASLDVNDS DKILRKEMAT LYSSLRSLLP  60
LQFIKGKRSI SDHMNEAVNY IKYMQNNIKE LGAKRDELKK KKNLSNYYHH HDNNDKPTSS  120
TNRYFTLHES DSGVLGIEIT GGAAAAGEEE GVTLSEILGL LVEEEGLEVI GYLSSKVNGR  180
LVHSVQCEVV NSNSVDLFEL RRKLAKEIKV VRILKKNFGD TYMEMRNFIS FSNHYNVK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016204160.11e-124PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0B2RHW12e-75A0A0B2RHW1_GLYSO; Transcription factor bHLH126
TrEMBLA0A151QME02e-75A0A151QME0_CAJCA; Transcription factor bHLH36
TrEMBLI1L3H64e-75I1L3H6_SOYBN; Uncharacterized protein
TrEMBLI1MQ592e-75I1MQ59_SOYBN; Uncharacterized protein
STRINGGLYMA09G27630.41e-74(Glycine max)
STRINGGLYMA16G32620.14e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25400.16e-23bHLH family protein